Uses of Interface
org.biopax.paxtools.model.BioPAXElement
Packages that use BioPAXElement
Package
Description
This package contains classes for implementing undoable editing the model.
This package contains various methods and algorithms for traversing and manipulating the model.
This package contains a tools for upgrading BioPAX L1 and L2 to L3.
This package contains the default BioPAX Model implementations.
This package contains the default implementation for BioPAX Level 3.
This package contains classes that handle IO operations including reading and writing BioPAX from files and streams..
This package contains the interfaces that maps to the OWL classes defined in the BioPAX specification.
This package contains the interfaces that maps to the BioPAX level 2 specification.
This package contains the interfaces that maps classes defined in the BioPAX Level 3 specification.
This package contains various collections and utilities that is used by the other packages and modules of paxtools.
-
Uses of BioPAXElement in org.biopax.paxtools.command
Classes in org.biopax.paxtools.command with type parameters of type BioPAXElementModifier and TypeClassDescriptionclassAbstractPropertyCommand<D extends BioPAXElement,R> classPropertySetCommand<D extends BioPAXElement,R> Methods in org.biopax.paxtools.command with parameters of type BioPAXElementModifier and TypeMethodDescriptionvoidCommandManager.addProperty(BioPAXElement bpe, PropertyEditor editor, Object value) protected abstract voidAbstractAddRemoveCommand.redoAction(BioPAXElement bpe) protected voidAddCommand.redoAction(BioPAXElement bpe) protected voidRemoveCommand.redoAction(BioPAXElement bpe) voidCommandManager.removeProperty(BioPAXElement bpe, PropertyEditor editor, Object value) protected abstract voidAbstractAddRemoveCommand.undoAction(BioPAXElement bpe) protected voidAddCommand.undoAction(BioPAXElement bpe) protected voidRemoveCommand.undoAction(BioPAXElement bpe) Method parameters in org.biopax.paxtools.command with type arguments of type BioPAXElementModifier and TypeMethodDescriptionvoidCommandManager.addObjects(Set<BioPAXElement> bpes) voidCommandManager.removeObjects(Set<BioPAXElement> bpes) Constructor parameters in org.biopax.paxtools.command with type arguments of type BioPAXElementModifierConstructorDescriptionAbstractAddRemoveCommand(Model model, Set<BioPAXElement> bpes) AddCommand(Model model, Set<BioPAXElement> bpes) RemoveCommand(Model model, Set<BioPAXElement> bpes) -
Uses of BioPAXElement in org.biopax.paxtools.controller
Classes in org.biopax.paxtools.controller with type parameters of type BioPAXElementModifier and TypeClassDescriptionclassAbstractPropertyEditor<D extends BioPAXElement,R> This is the base class for all property editors.interfaceDataPropertyEditor<D extends BioPAXElement,R> Created by igor on 13/08/15.classDecoratingPropertyAccessor<D extends BioPAXElement,R> classEnumeratedPropertyEditor<D extends BioPAXElement,R extends Enum> Provides an ENUM class compatible editor by extending thePropertyEditor.classFilteredByDomainPropertyAccessor<D extends BioPAXElement,R> This class is a decorating property accessor that filters the seed arguments, only accepts if they are assignable to filter class.classFilteredPropertyAccessor<D extends BioPAXElement,R> This class is a decorating property accessor that filters values with a given class.classObjectPropertyEditor<D extends BioPAXElement,R extends BioPAXElement> Provides an editor for all object value types, e.g.classObjectPropertyEditor<D extends BioPAXElement,R extends BioPAXElement> Provides an editor for all object value types, e.g.classPrimitivePropertyEditor<D extends BioPAXElement,R> Provides a primitive (int, float, double) class compatible editor by extending thePropertyEditor.interfacePropertyAccessor<D extends BioPAXElement,R> Allows generic access to the properties or a path of properties from a bean.classPropertyAccessorAdapter<D extends BioPAXElement,R> Adapter class for all property accessors.interfacePropertyEditor<D extends BioPAXElement,R> classSimplePropertyAccessor<D extends BioPAXElement,R> classStringPropertyEditor<D extends BioPAXElement>Provides an String class compatible editor by extending thePropertyEditor.classTransitivePropertyAccessor<R extends BioPAXElement,D extends R> This class is a transitive decorator for PropertyAccessors.classUnionPropertyAccessor<D extends BioPAXElement,R> In OWL a single property can have multiple domains.Fields in org.biopax.paxtools.controller with type parameters of type BioPAXElementModifier and TypeFieldDescriptionprotected final Map<Class<? extends BioPAXElement>, Map<String, PropertyEditor>> EditorMapImpl.classToEditorMapA map from classes to their registered editors.protected final Map<Class<? extends BioPAXElement>, Set<PropertyEditor>> EditorMapImpl.classToEditorSetAnother map to keep editors as a set rather than a map.protected final Map<Class<? extends BioPAXElement>, Set<ObjectPropertyEditor>> EditorMapImpl.classToInverseEditorMapA map from classes to their registered inverse editorsprotected final Set<BioPAXElement> AbstractTraverser.visitedMethods in org.biopax.paxtools.controller with type parameters of type BioPAXElementModifier and TypeMethodDescription<T extends BioPAXElement>
TCreates a copy of the BioPAX object with all its properties are the same, and also adds it to a model.<T extends BioPAXElement>
TReturns a copy of the BioPAX element (with all the property values are same)static <D extends BioPAXElement,R>
PropertyAccessor<D, R> FilteredByDomainPropertyAccessor.create(PropertyAccessor<D, R> pa, Class filter) FactoryMethod that creates a filtered-by-domain property accessor by decorating a given accessor with a class filter.static <D extends BioPAXElement,R>
PropertyAccessor<D, R> FilteredPropertyAccessor.create(PropertyAccessor<D, R> pa, Class filter) FactoryMethod that creates a filtered property accessor by decorating a given accessor with a class filter.static <R extends BioPAXElement,D extends R>
TransitivePropertyAccessor<R, D> TransitivePropertyAccessor.create(PropertyAccessor<D, R> pa) static <D extends BioPAXElement,R>
PropertyEditor<D, R> AbstractPropertyEditor.createPropertyEditor(Class<D> domain, String property) This method creates a property reflecting on the domain and property.<T extends BioPAXElement>
Set<T> Fetcher.fetch(BioPAXElement element, Class<T> filterByType) Goes over object type biopax properties to collect nested objects (using only properties that pass all the filters set in Constructor, and taking #isSkipSubPathways into account) of the given biopax element, its children, etc.<D extends BioPAXElement>
PropertyEditor<? super D, ?> EditorMap.getEditorForProperty(String property, Class<D> javaClass) This method returns the editor intended to handle property named property of a class (javaClass).<D extends BioPAXElement>
PropertyEditor<? super D, ?> EditorMapImpl.getEditorForProperty(String property, Class<D> javaClass) <D extends BioPAXElement>
PropertyEditor<? super D, ?> SimpleEditorMap.getEditorForProperty(String property, Class<D> javaClass) <E extends BioPAXElement>
Set<? extends Class<E>> EditorMap.getKnownSubClassesOf(Class<E> javaClass) Returns a set of sub classes of a given class.<E extends BioPAXElement>
Set<? extends Class<E>> EditorMapImpl.getKnownSubClassesOf(Class<E> javaClass) <E extends BioPAXElement>
Set<? extends Class<E>> SimpleEditorMap.getKnownSubClassesOf(Class<E> javaClass) static <T extends BioPAXElement>
TA more strict, type-safe way to ask for a biopax object from the model, unlikeModel.getByID(String).static <T extends BioPAXElement>
Set<T> ModelUtils.getRootElements(Model model, Class<T> filterClass) Finds "root" BioPAX objects that belong to a particular class (incl.<D extends BioPAXElement>
Set<PropertyEditor<? extends D, ?>> EditorMap.getSubclassEditorsForProperty(String property, Class<D> domain) This method returns the set of editors intended to handle property named property.<D extends BioPAXElement>
Set<PropertyEditor<? extends D, ?>> EditorMapImpl.getSubclassEditorsForProperty(String property, Class<D> domain) <D extends BioPAXElement>
Set<PropertyEditor<? extends D, ?>> SimpleEditorMap.getSubclassEditorsForProperty(String property, Class<D> domain) static <T extends BioPAXElement>
Set<BioPAXElement> ModelUtils.removeObjectsIfDangling(Model model, Class<T> clazz) Iteratively removes "dangling" elements of given type and its sub-types, e.g.<D extends BioPAXElement>
void<D extends BioPAXElement>
voidTraverse and visitVisitorall properties of the element.Methods in org.biopax.paxtools.controller that return types with arguments of type BioPAXElementModifier and TypeMethodDescriptionCompleter.complete(Collection<BioPAXElement> elements) Completer.complete(Collection<BioPAXElement> elements, Model model) Deprecated.Fetcher.fetch(BioPAXElement element) Recursively finds and collects all child objects, while escaping possible infinite loops.Fetcher.fetch(BioPAXElement bpe, int depth) Recursively collects unique child objects from BioPAX object type properties that pass all the filters (as set via Constructor).static Map<Class<? extends BioPAXElement>, Integer> ModelUtils.generateClassMetrics(Model model) Generates simple counts of different elements in the model.Merger.getAddedElements()After a merge is accomplished, this set will contain the newly added elements.static Set<BioPAXElement> ModelUtils.getDirectChildrenAsSet(BioPAXElement bpe) Collects direct children of a given BioPAX element.Merger.getMergedElements()After a merge is accomplished, this set will contain the merged elements.Map<Class<? extends BioPAXElement>, Set<Class<? extends BioPAXElement>>> ObjectPropertyEditor.getRestrictedRanges()Map<Class<? extends BioPAXElement>, Set<Class<? extends BioPAXElement>>> ObjectPropertyEditor.getRestrictedRanges()Set<Class<? extends BioPAXElement>> ObjectPropertyEditor.getRestrictedRangesFor(Class<? extends D> restrictedDomain) static <T extends BioPAXElement>
Set<BioPAXElement> ModelUtils.removeObjectsIfDangling(Model model, Class<T> clazz) Iteratively removes "dangling" elements of given type and its sub-types, e.g.Methods in org.biopax.paxtools.controller with parameters of type BioPAXElementModifier and TypeMethodDescriptionbooleanPathAccessor.applies(BioPAXElement bpe) Fetcher.fetch(BioPAXElement element) Recursively finds and collects all child objects, while escaping possible infinite loops.Fetcher.fetch(BioPAXElement bpe, int depth) Recursively collects unique child objects from BioPAX object type properties that pass all the filters (as set via Constructor).<T extends BioPAXElement>
Set<T> Fetcher.fetch(BioPAXElement element, Class<T> filterByType) Goes over object type biopax properties to collect nested objects (using only properties that pass all the filters set in Constructor, and taking #isSkipSubPathways into account) of the given biopax element, its children, etc.voidFetcher.fetch(BioPAXElement element, Model model) Adds the element and all its children (found via traversing into object properties that pass all the filters defined in the Constructor, and also taking #isSkipSubPathways into account) to the target model.IdFetcher.fetchID(BioPAXElement ele) static voidModelUtils.fixDanglingInverseProperties(BioPAXElement bpe, Model model) Unlinks inverse properties of the BioPAX object from values the model does not have.static voidModelUtils.fixDanglingObjectProperties(BioPAXElement bpe, Model model) Unlinks object properties of the BioPAX object from values the model does not have.ReusedPEPHelper.fixReusedPEP(physicalEntityParticipant pep, BioPAXElement bpe) static ModelModelUtils.getAllChildren(BioPAXElement bpe, Filter<PropertyEditor>... filters) Deprecated.useFetcher.fetch(BioPAXElement, Model)instead (with Fetcher.nextStepFilter or without)static Set<Provenance> ModelUtils.getDatasources(BioPAXElement biopaxElement) Collects all Provenance objects associated with this one as follows: - if the element is Entity (has 'dataSource' property) or is Provenence itself, get the values and quit; - if the biopax element is PathwayStep or EntityReference, traverse into some of its object/inverse properties to collect dataSource values from associated entities.static ModelModelUtils.getDirectChildren(BioPAXElement bpe) Gets direct children of a given BioPAX element and adds them to a new model.static Set<BioPAXElement> ModelUtils.getDirectChildrenAsSet(BioPAXElement bpe) Collects direct children of a given BioPAX element.EditorMap.getEditorsOf(BioPAXElement bpe) This method returns the set of editors whose domain subsumes the class of given BioPAX element.EditorMapImpl.getEditorsOf(BioPAXElement bpe) SimpleEditorMap.getEditorsOf(BioPAXElement bpe) EditorMap.getInverseEditorsOf(BioPAXElement bpe) Properties in BioPAX specification is unidirectional.EditorMapImpl.getInverseEditorsOf(BioPAXElement bpe) SimpleEditorMap.getInverseEditorsOf(BioPAXElement bpe) ModelUtils.getKeywords(BioPAXElement biopaxElement, int depth, Filter<DataPropertyEditor>... dataPropertyFilters) Collects data type (not object) property values (can be then used for full-text indexing).ModelUtils.getOrganisms(BioPAXElement biopaxElement) Collects BioSource objects from this or related elements (where it makes sense; though the biopax element might have no or empty 'organism' property at all.ModelUtils.getParentPathways(BioPAXElement biopaxElement) Collects all parent Pathway objects recursively traversing the inverse object properties of the biopax element.PathAccessor.getValueFromBean(BioPAXElement bean) static booleanModelUtils.isGeneric(BioPAXElement e) Checks whether the BioPAX element is generic physical entity or entity reference.voidSimpleMerger.merge(Model target, BioPAXElement source) Merges the source element (and its "downstream" dependents) into target model.booleanFetcher.subgraphContains(BioPAXElement root, String uri, Class<? extends BioPAXElement> type) Iterates over child objects of the given biopax element, using BioPAX object-type properties, until the element with specified URI and class (including its sub-classes).voidTraverserBilinked.traverse(BioPAXElement element, Model model) protected voidTraverser.traverseElements(BioPAXElement element, Model model, PropertyEditor<?, ?> editor, Set<?> valueSet) static voidModelUtils.updateUri(Model model, BioPAXElement el, String newUri) Replaces the URI of a BioPAX object in the Model using java reflection.protected abstract voidAbstractTraverser.visit(Object range, BioPAXElement domain, Model model, PropertyEditor<?, ?> editor) This is to implement a real action here: do something, return or even to continue (traverse) into the child (range) element's properties if it's a BioPAX object.voidAbstractTraverser.visit(BioPAXElement domain, Object range, Model model, PropertyEditor<?, ?> editor) Calls the protected abstract method visit that is to be implemented in subclasses of this abstract class.voidCloner.visit(BioPAXElement domain, Object range, Model targetModel, PropertyEditor editor) voidCompleter.visit(BioPAXElement domain, Object range, Model model, PropertyEditor editor) voidMerger.visit(BioPAXElement domain, Object range, Model model, PropertyEditor editor) Checks whether model contains bpe element, and if it does, then it updates the value of the equivalent element for bpe by using the specific editor.voidShallowCopy.visit(BioPAXElement domain, Object range, Model model, PropertyEditor editor) An implementation of this method should perform a BioPAX element and editor dependent operation on the model.voidVisitor.visit(BioPAXElement domain, Object range, Model model, PropertyEditor<?, ?> editor) An implementation of this method should perform a BioPAX element and editor dependent operation on the model.Method parameters in org.biopax.paxtools.controller with type arguments of type BioPAXElementModifier and TypeMethodDescriptionvoidObjectPropertyEditor.addRangeRestriction(Class<? extends BioPAXElement> domain, Set<Class<? extends BioPAXElement>> ranges) This method adds a range restriction to the property editor.voidObjectPropertyEditor.addRangeRestriction(Class<? extends BioPAXElement> domain, Set<Class<? extends BioPAXElement>> ranges) This method adds a range restriction to the property editor.Cloner.clone(Set<BioPAXElement> toBeCloned) For each element from the 'toBeCloned' list, it creates a copy in the new model, setting all the data properties; however, object property values that refer to BioPAX elements not in 'toBeCloned' list are ignored.Cloner.clone(Model source, Set<BioPAXElement> toBeCloned) Deprecated.useCloner.clone(Set)instead ('source' model was not used in previous versions)Completer.complete(Collection<BioPAXElement> elements) Completer.complete(Collection<BioPAXElement> elements, Model model) Deprecated.useCompleter.complete(Collection)instead (- model is never explicitly used there)protected PropertyEditorEditorMapImpl.createAndRegisterBeanEditor(String pName, Class domain, Map<Class<? extends BioPAXElement>, Set<Class<? extends BioPAXElement>>> rRestrictions) protected PropertyEditorEditorMapImpl.createAndRegisterBeanEditor(String pName, Class domain, Map<Class<? extends BioPAXElement>, Set<Class<? extends BioPAXElement>>> rRestrictions) EditorMap.getEditorsOf(Class<? extends BioPAXElement> domain) This method returns the set of editors whose domain subsumes the given classEditorMapImpl.getEditorsOf(Class<? extends BioPAXElement> domain) SimpleEditorMap.getEditorsOf(Class<? extends BioPAXElement> domain) EditorMap.getInverseEditorsOf(Class<? extends BioPAXElement> domain) Properties in BioPAX specification is unidirectional.EditorMapImpl.getInverseEditorsOf(Class<? extends BioPAXElement> domain) SimpleEditorMap.getInverseEditorsOf(Class<? extends BioPAXElement> domain) PathAccessor.getValueFromBeans(Collection<? extends BioPAXElement> beans) protected booleanAbstractPropertyEditor.isInstanceOfAtLeastOne(Set<Class<? extends BioPAXElement>> classes, Object value) Checks if value is an instance of one of the classes given in a set.voidSimpleMerger.merge(Model target, Collection<? extends BioPAXElement> elements) Merges the elements and all their child biopax objects into the target model.protected voidEditorMapImpl.registerEditorsWithSubClasses(PropertyEditor editor, Class<? extends BioPAXElement> domain) This method registers an editor with sub classes - i.e.static voidModelUtils.replace(Model model, Map<? extends BioPAXElement, ? extends BioPAXElement> subs) Replaces BioPAX elements in the model with ones from the map, updates corresponding BioPAX object references.static voidModelUtils.replace(Model model, Map<? extends BioPAXElement, ? extends BioPAXElement> subs) Replaces BioPAX elements in the model with ones from the map, updates corresponding BioPAX object references.voidObjectPropertyEditor.setRangeRestriction(Map<Class<? extends BioPAXElement>, Set<Class<? extends BioPAXElement>>> restrictedRanges) This method sets all range restrictions.voidObjectPropertyEditor.setRangeRestriction(Map<Class<? extends BioPAXElement>, Set<Class<? extends BioPAXElement>>> restrictedRanges) This method sets all range restrictions.booleanFetcher.subgraphContains(BioPAXElement root, String uri, Class<? extends BioPAXElement> type) Iterates over child objects of the given biopax element, using BioPAX object-type properties, until the element with specified URI and class (including its sub-classes).Constructor parameters in org.biopax.paxtools.controller with type arguments of type BioPAXElementModifierConstructorDescriptionPathAccessor(List<PropertyAccessor<? extends BioPAXElement, ?>> objectAccessors, BioPAXLevel level) Constructor for defining the access path with a list of accessors.SimpleMerger(EditorMap map, Filter<BioPAXElement> mergePropOf) -
Uses of BioPAXElement in org.biopax.paxtools.converter
Methods in org.biopax.paxtools.converter with parameters of type BioPAXElementModifier and TypeMethodDescriptionstatic StringLevelUpgrader.getLocalId(BioPAXElement bpe) Gets the local part of the BioPAX element ID.protected voidLevelUpgrader.visit(Object value, BioPAXElement parent, Model newModel, PropertyEditor editor) -
Uses of BioPAXElement in org.biopax.paxtools.impl
Classes in org.biopax.paxtools.impl that implement BioPAXElementFields in org.biopax.paxtools.impl with type parameters of type BioPAXElementMethods in org.biopax.paxtools.impl with type parameters of type BioPAXElementModifier and TypeMethodDescription<T extends BioPAXElement>
T<T extends BioPAXElement>
T<T extends BioPAXElement>
T[]<T extends BioPAXElement>
T[]<T extends BioPAXElement>
Set<T> ModelImpl.getObjects(Class<T> filterBy) Methods in org.biopax.paxtools.impl that return BioPAXElementMethods in org.biopax.paxtools.impl that return types with arguments of type BioPAXElementMethods in org.biopax.paxtools.impl with parameters of type BioPAXElementModifier and TypeMethodDescriptionvoidModelImpl.add(BioPAXElement aBioPAXElement) voidMockFactory.bindArrays(String editor, BioPAXElement[] beans, BioPAXElement[] values) voidMockFactory.bindArrays(ObjectPropertyEditor editor, BioPAXElement[] beans, BioPAXElement[] values) voidMockFactory.bindInPairs(String editor, BioPAXElement... pairs) voidMockFactory.bindInPairs(ObjectPropertyEditor editor, BioPAXElement... pairs) booleanModelImpl.contains(BioPAXElement aBioPAXElement) This method returns true if given element is the same object ("==") as the object stored in the model usually (for self-consistent models) but not necessarily under the element's ID.booleanBioPAXElementImpl.isEquivalent(BioPAXElement element) voidModelImpl.remove(BioPAXElement aBioPAXElement) voidModelImpl.replace(BioPAXElement existing, BioPAXElement replacement) It does not automatically replace or clean up the old element's object properties, therefore, some child elements may become "dangling" if they were used by the replaced element only.protected booleanBioPAXElementImpl.semanticallyEquivalent(BioPAXElement element) Method parameters in org.biopax.paxtools.impl with type arguments of type BioPAXElementModifier and TypeMethodDescriptionMockFactory.editor(String property, Class<? extends BioPAXElement> clazz) MockFactory.mapClassName(Class<? extends BioPAXElement> aClass) -
Uses of BioPAXElement in org.biopax.paxtools.impl.level3
Classes in org.biopax.paxtools.impl.level3 that implement BioPAXElementModifier and TypeClassDescriptionclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassBase BioPAX Level3 element.classclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassclassThis class helps with managing the bidirectional xref links.classMethods in org.biopax.paxtools.impl.level3 with parameters of type BioPAXElementModifier and TypeMethodDescriptionprotected booleanBindingFeatureImpl.semanticallyEquivalent(BioPAXElement element) protected booleanBioSourceImpl.semanticallyEquivalent(BioPAXElement element) protected booleanChemicalConstantImpl.semanticallyEquivalent(BioPAXElement element) protected booleanChemicalStructureImpl.semanticallyEquivalent(BioPAXElement element) protected booleanComplexImpl.semanticallyEquivalent(BioPAXElement element) protected booleanControlledVocabularyImpl.semanticallyEquivalent(BioPAXElement element) protected booleanConversionImpl.semanticallyEquivalent(BioPAXElement element) protected booleanCovalentBindingFeatureImpl.semanticallyEquivalent(BioPAXElement element) protected booleanDeltaGImpl.semanticallyEquivalent(BioPAXElement element) protected booleanEntityFeatureImpl.semanticallyEquivalent(BioPAXElement element) protected booleanEntityImpl.semanticallyEquivalent(BioPAXElement element) protected booleanEvidenceImpl.semanticallyEquivalent(BioPAXElement element) Answers whether two Evidence objects are semantically equivalent.protected booleanFragmentFeatureImpl.semanticallyEquivalent(BioPAXElement element) protected booleanKPrimeImpl.semanticallyEquivalent(BioPAXElement element) protected booleanModificationFeatureImpl.semanticallyEquivalent(BioPAXElement element) protected booleanPhysicalEntityImpl.semanticallyEquivalent(BioPAXElement element) protected booleanPublicationXrefImpl.semanticallyEquivalent(BioPAXElement other) protected booleanRelationshipXrefImpl.semanticallyEquivalent(BioPAXElement other) protected booleanSequenceEntityReferenceImpl.semanticallyEquivalent(BioPAXElement element) protected booleanSequenceIntervalImpl.semanticallyEquivalent(BioPAXElement element) protected booleanSequenceSiteImpl.semanticallyEquivalent(BioPAXElement element) protected booleanSimplePhysicalEntityImpl.semanticallyEquivalent(BioPAXElement element) protected booleanSmallMoleculeReferenceImpl.semanticallyEquivalent(BioPAXElement element) protected booleanStoichiometryImpl.semanticallyEquivalent(BioPAXElement element) protected booleanUnificationXrefImpl.semanticallyEquivalent(BioPAXElement other) protected booleanXrefImpl.semanticallyEquivalent(BioPAXElement other) -
Uses of BioPAXElement in org.biopax.paxtools.io
Methods in org.biopax.paxtools.io with parameters of type BioPAXElementModifier and TypeMethodDescriptionprotected voidBioPAXIOHandlerAdapter.bindValue(String valueString, PropertyEditor editor, BioPAXElement bpe, Model model) This method binds the value to the bpe.protected StringPropertyEditorBioPAXIOHandlerAdapter.getRDFCommentEditor(BioPAXElement bpe) Paxtools maps BioPAX:comment (L3) and BioPAX:COMMENT (L2) to rdf:comment.protected ObjectBioPAXIOHandlerAdapter.resourceFixes(BioPAXElement bpe, Object value) This method currently only fixes reusedPEPs if the option is set.voidSimpleIOHandler.writeObject(Writer out, BioPAXElement bean) Writes the XML representation of individual BioPAX element that is BioPAX-like but only for display or debug purpose (incomplete). -
Uses of BioPAXElement in org.biopax.paxtools.model
Methods in org.biopax.paxtools.model with type parameters of type BioPAXElementModifier and TypeMethodDescription<T extends BioPAXElement>
TThis method creates a new object using the model's factory, adds it to the model and returns it.<T extends BioPAXElement>
TUniversal method that creates a new BioPAX object.<T extends BioPAXElement>
Class<T> BioPAXFactory.getImplClass(Class<T> aModelInterfaceClass) Get a concrete or abstract BioPAX type (not interface), from org.biopax.paxtools.impl..*, i.e., one that has persistence/search annotations, etc.<T extends BioPAXElement>
Set<T> Model.getObjects(Class<T> filterBy) This method returns a set of objects in the model of the given class.Methods in org.biopax.paxtools.model that return BioPAXElementModifier and TypeMethodDescriptionThis method returns the biopax element with the given id, returns null if the object with the given id does not exist in this model.Methods in org.biopax.paxtools.model that return types with arguments of type BioPAXElementModifier and TypeMethodDescriptionClass<? extends BioPAXElement> BioPAXLevel.getInterfaceForName(String localName) Gets the BioPAX type (java interface) by name.Class<? extends BioPAXElement> BioPAXElement.getModelInterface()This method returns the actual model interface that a class implements.Model.getObjects()This method returns a set of objects in the model.Methods in org.biopax.paxtools.model with parameters of type BioPAXElementModifier and TypeMethodDescriptionvoidModel.add(BioPAXElement aBioPAXElement) This method adds the given object to this model.booleanModel.contains(BioPAXElement aBioPAXElement) This method returns true if the parameter is contained within this model.booleanBioPAXLevel.hasElement(BioPAXElement element) booleanBioPAXElement.isEquivalent(BioPAXElement element) This method compares the given element for equivalency.voidModel.remove(BioPAXElement aBioPAXElement) This method removes the given BioPAX Element from the model.voidModel.replace(BioPAXElement existing, BioPAXElement replacement) Replaces existing BioPAX element with another one, of the same or possibly equivalent type, and updates all the affected references to it (object properties).Method parameters in org.biopax.paxtools.model with type arguments of type BioPAXElementModifier and TypeMethodDescriptionbooleanBioPAXFactory.canInstantiate(Class<? extends BioPAXElement> aClass) Checks whether objects of a BioPAX model interface can be created (some types are not official BioPAX types, abstract classes).abstract StringBioPAXFactory.mapClassName(Class<? extends BioPAXElement> aClass) Maps a BioPAX type (model interface) to the full-qualified class name of an implementing class. -
Uses of BioPAXElement in org.biopax.paxtools.model.level2
Subinterfaces of BioPAXElement in org.biopax.paxtools.model.level2Modifier and TypeInterfaceDescriptioninterfaceA conversion interaction in which one or more entities (substrates) undergo ovalent changes to become one or more other entities (products).interfaceThe biological source of an entity (e.g.interfaceA control interaction in which a physical entity (a catalyst) increases the rate of a conversion interaction by lowering its activation energy.interfaceDescribes a small molecule structure.interfaceA physical entity whose structure is comprised of other physical entities bound to each other non-covalently, at least one of which is a macromolecule (e.g.interfaceA conversion interaction in which a set of physical entities, at least one being a macromolecule (e.g.interfaceConfidence that the containing instance actually occurs or exists in vivo, usually a statistical measure.interfaceinterfaceinterfaceXREF Should be only unification and publication xrefsinterfaceinterfaceinterfaceThis class represents a discrete biological unit used when describing pathways.interfaceinterfaceinterfaceinterfaceinterfacemarker interface for entities and PEPsinterfaceinterfaceCreated by IntelliJ IDEA.interfaceget controlled should be catalysisinterfaceinterfaceinterfaceInterface for pathway steps and processesinterfaceThis represents a set of pathway events.interfaceinterfaceinterfaceinterfaceTagging interface for entities that needs evidence and can be targeted by a control : Pathway and InteractioninterfaceinterfaceinterfaceinterfaceinterfaceUser: root Date: Aug 7, 2006 Time: 4:51:19 PM_DOTinterfaceinterfaceinterfaceinterfaceinterfaceinterfaceinterfaceinterfaceinterfaceinterfaceinterfaceinterface -
Uses of BioPAXElement in org.biopax.paxtools.model.level3
Subinterfaces of BioPAXElement in org.biopax.paxtools.model.level3Modifier and TypeInterfaceDescriptioninterfaceinterfaceDefinition: Imposes ordering on a step in a biochemical pathway.interfaceDefinition: A conversion interaction in which one or more entities (substrates) undergo covalent changes to become one or more other entities (products).interfaceDefinition: The biological source of an entity (e.g.interfaceDefinition: A control interaction in which a physical entity (a catalyst) increases the rate of a conversion interaction by lowering its activation energy.interfaceDefinition: A reference to the Gene Ontology Cellular Component (GO CC) ontology.interfaceDefinition: A reference to the Cell Type Ontology (CL).interfaceinterfaceDefinition: The chemical structure of a small molecule.interfaceDefinition: A physical entity whose structure is comprised of other physical entities bound to each other non-covalently, at least one of which is a macromolecule (e.g.interfaceDefinition: A conversion interaction in which a set of physical entities, at least one being a macromolecule (e.g.interfaceDefinition: An interaction in which one entity regulates, modifies, or otherwise influences a continuant entity, i.e.interfaceDefinition: This class represents a term from an external controlled vocabulary (CV).interfaceThis is a role interface for pathway elements that can control processes, namelyPathwayandPhysicalEntity.interfaceDefinition: An interaction in which molecules of one or morePhysicalEntitypools are physically transformed and become a member of one or more other PhysicalEntity pools.interfaceDefinition: An entity feature that represent the covalently bound state of a physical entity.interfaceDefinition: A conversion in which a pool of macromolecules are degraded into their elementary units.interfaceStandard transformed Gibbs energy change for a reaction written in terms of biochemical reactants (sums of species), delta-G'o.interfaceDefinition: A physical entity consisting of a sequence of deoxyribonucleotide monophosphates; a deoxyribonucleic acid.interfaceA DNA reference is a grouping of several DNA entities that are common in sequence and genomic position.interfaceDefinition: A region on a DNA molecule.interfaceDefinition: A DNARegionReference is a grouping of several DNARegion entities that are common in sequence and genomic position.interfaceThis class represents a discrete biological unit used when describing pathways.interfaceDescription: A characteristic of a physical entity that can change while the entity still retains its biological identity.interfaceDefinition: An entity reference is a grouping of several physical entities across different contexts and molecular states, that share common physical properties and often named and treated as a single entity with multiple states by biologists.interfaceDefiniiton: A reference to a term from an entity reference group ontology.interfaceDefinition: The support for a particular assertion, such as the existence of an interaction or pathway.interfaceDefinition: A reference to the PSI Molecular Interaction ontology experimental method types, including "interaction detection method", "participant identification method", "feature detection method".interfaceDefinition: The form of a physical entity in a particular experiment, as it may be modified for purposes of experimental design.interfaceDefinition: A term that describes the form of the physical entity in the context of the experiment.interfaceDefinition: An entity feature that represents the resulting physical entity subsequent to a cleavage or degradation event.interfaceDefinition: A continuant that encodes information that can be inherited through replication.interfaceDefinition : Genetic interactions between genes occur when two genetic perturbations (e.g.interfaceDefinition: A biological relationship between two or more entities.interfaceA reference to the PSI Molecular Interaction ontology (MI) interaction type.interfaceThe apparent equilibrium constant, K', and associated values.interfaceA Level 3 specific element.interfaceDefinition: A covalently modified feature on a sequence, relevant to an interaction, such as a post-translational modification.interfaceDefinition: An interaction in which one entity regulates, modifies, or otherwise influences another.interfaceDefinition: An interaction in which at least one participant is a physical entity, e.g.interfaceInterface for all classes that can have names in BioPAX.interfaceTagger interface for DNA and RNAinterfaceRole interface for NucleicAcidReferences, namely DNA and RNA.interfaceinterfaceUser: demir Date: Aug 17, 2007 Time: 5:47:27 PMinterfaceinterfaceThis represents a set of pathway events.interfaceinterfaceinterfaceTagging interface for entities that can participate in a pathway and can be targeted by a control : Pathway and InteractioninterfaceinterfaceDescription: A protein reference is a grouping of several protein entities that are encoded by the same genetic sequence.interfaceDefinition: The direct source of a pathway data or score.interfaceinterfaceVocabulary for defining relationship Xref types.interfaceDefinition: An xref that defines a reference to an entity in an external resource that does not have the same biological identity as the referring entity.interfaceinterfaceinterfaceDefinition: A region on a RNA molecule.interfaceA RNA region referenceinterfaceDefinition: A score associated with a publication reference describing how the score was determined, the name of the method and a comment briefly describing the method.interfaceTagger interface for macromolecules that are related to a genetic sequence: DNA, RNA, Protein.interfaceTagger interface for protein, dna and rna entitiesinterfaceinterfaceDefinition: A location on a nucleotide or amino acid sequence.interfaceDefinition: A term that describes the covalent modifications to an amino acid or nucleic acid chain.interfaceDefinition: A reference to a controlled vocabulary of sequence regions, such as InterPro or Sequence Ontology (SO) Homepage at http://www.sequenceontology.org.interfaceinterfaceTagger interface for non-complex physical entitiesinterfaceinterfaceinterfaceStoichiometric coefficient of a physical entity in the context of a conversion or complex.interfaceinterfaceinterfaceDefinition: A reference to the BRENDAinterfaceinterfaceinterfaceDefinition: A unification xref defines a reference to an entity in an external resource that has the same biological identity as the referring entity.interfaceinterfaceinterface -
Uses of BioPAXElement in org.biopax.paxtools.util
Classes in org.biopax.paxtools.util with type parameters of type BioPAXElementModifier and TypeClassDescriptionclassBiopaxSafeSet<E extends BioPAXElement>A thread-safe set of BioPAX objects that also prevents adding several elements having the same URI.classEquivalenceGrouper<T extends BioPAXElement>Utility class for equivalence based comparison of a set of BioPAXElements.Methods in org.biopax.paxtools.util with type parameters of type BioPAXElementModifier and TypeMethodDescription<R extends BioPAXElement>
Set<R> BPCollections.createSafeSet()static <T extends BioPAXElement>
Set<T> SetEquivalenceChecker.findEquivalentIntersection(Set<? extends T> set1, Set<? extends T> set2) static <T extends BioPAXElement>
booleanSetEquivalenceChecker.hasEquivalentIntersection(Set<? extends T> set1, Set<? extends T> set2) static <T extends BioPAXElement>
booleanSetEquivalenceChecker.isEquivalent(Set<? extends T> set1, Set<? extends T> set2) Methods in org.biopax.paxtools.util with parameters of type BioPAXElementModifier and TypeMethodDescriptionstatic booleanSetEquivalenceChecker.containsEquivalent(Set<? extends BioPAXElement> set, BioPAXElement query) Method parameters in org.biopax.paxtools.util with type arguments of type BioPAXElementModifier and TypeMethodDescriptionstatic booleanSetEquivalenceChecker.containsEquivalent(Set<? extends BioPAXElement> set, BioPAXElement query)
Completer.complete(Collection)instead (- model is never explicitly used there)